PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G370600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HRT-like
Protein Properties Length: 449aa    MW: 50012.7 Da    PI: 9.9736
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G370600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like50.24.2e-16255284130
           HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                        +CG+ l+dGsvC ++P++gRKRC eHKG+R
  Aqcoe5G370600.1.p 255 VCGLFLGDGSVCINKPIEGRKRCGEHKGKR 284
                        7****************************9 PP

2HRT-like54.32.3e-17368398131
           HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                        +CGv l+d svCk++P+ gRKRCeeHKGmR+
  Aqcoe5G370600.1.p 368 VCGVVLNDQSVCKNSPAVGRKRCEEHKGMRV 398
                        7*****************************7 PP

3HRT-like49.28.9e-16413442130
           HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                        +CGv+l+dG +C+r Pv gRKRC  HKG+R
  Aqcoe5G370600.1.p 413 VCGVALGDGDFCMRVPVYGRKRCGIHKGRR 442
                        7****************************9 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MGFSSLELSR LKREECKRTK HDSVFSQWEI LIGPFDWENH SLGKNGIERY RIHNIPISCS  60
CPGLYELGVA AVQTDLGRDI RKLSLDSVVV VYLGQADNVR TRLQHYGRAG SHLDHGKFFG  120
EPSDDHYNLK GPGLFSEIFS RGFPIVFRWA SMENKKLAEK TEGRLLSIFD YAWNKGGNGA  180
RRPNDIYLNL DKIVSSNISS PSIPRKLHNW LKTNLLHRKK KGIKIETNSP PFERVKLKPR  240
LLTVKQDFNE EYPSVCGLFL GDGSVCINKP IEGRKRCGEH KGKRNIGSSS RSKTPRKLLV  300
SSLPLKAEPV CISSMPLKAE PVCISSMPLK AEPVCTKVSM PGGKSCELYE EKWAGSPQNL  360
LHEELNNVCG VVLNDQSVCK NSPAVGRKRC EEHKGMRVNK ALSKSTTEGN FGVCGVALGD  420
GDFCMRVPVY GRKRCGIHKG RRAVATHI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262192.11e-139PREDICTED: uncharacterized protein LOC104600759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.13e-76effector of transcription2